SCOPe 2.05: Domain d3kqfd_: 3kqf D:

Lineage for d3kqfd_ (3kqf D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225790] (1 PDB entry)

8. Domain d3kqfd_: 3kqf D: [212486]
   automated match to d3p5mf_
   complexed with ca, cl

Details for d3kqfd_

PDB Entry: 3kqf, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis.

PDB Compounds: (D:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d3kqfd_:

Sequence; same for both SEQRES and ATOM records:

>d3kqfd_ c.14.1.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lqnisvdyatphvvkislnrerqanslslalleelqniltqineeantrvviltgageka
fcagadlkeragmneeqvrhavsmirttmemveqlpqpviaaingialgggtelslacdf
riaaesaslgltettlaiipgaggtqrlprligvgrakeliytgrrisaqeakeyglvef
vvpvhlleekaieiaekiasngpiavrlakeaisngiqvdlhtglqmekqayegvihtkd
rleglqafkekrtpmykge

Timeline for d3kqfd_:

• d3kqfd_ first appeared in SCOPe 2.03
  
• d3kqfd_ appears in SCOPe 2.04
  
• d3kqfd_ appears in SCOPe 2.06
  
• d3kqfd_ appears in the current release, SCOPe 2.08