Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (42 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225790] (1 PDB entry) |
Domain d3kqfa_: 3kqf A: [212483] automated match to d3p5mf_ complexed with ca, cl |
PDB Entry: 3kqf (more details), 1.8 Å
SCOPe Domain Sequences for d3kqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kqfa_ c.14.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} lqnisvdyatphvvkislnrerqanslslalleelqniltqineeantrvviltgageka fcagadlkeragmneeqvrhavsmirttmemveqlpqpviaaingialgggtelslacdf riaaesaslgltettlaiipgaggtqrlprligvgrakeliytgrrisaqeakeyglvef vvpvhlleekaieiaekiasngpiavrlakeaisngiqvdlhtglqmekqayegvihtkd rleglqafkekrtpmykge
Timeline for d3kqfa_: