![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
![]() | Protein automated matches [190672] (17 species) not a true protein |
![]() | Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries) |
![]() | Domain d3koqc_: 3koq C: [212481] automated match to d2b67a1 complexed with cl, fmn, gol |
PDB Entry: 3koq (more details), 1.58 Å
SCOPe Domain Sequences for d3koqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3koqc_ d.90.1.0 (C:) automated matches {Clostridium difficile [TaxId: 272563]} mnfvelakkryscrnyqdrkvekeklekvldvariaptggnrqpqrliviqekeginkls kaaniydaplailvcgdkdkvwtrpfdgkqltdidtsivtdhmmlqatelglasvwvcyf npdiireefslpdnlepinillmgyeskipesperhektrvplseivsyetl
Timeline for d3koqc_: