Lineage for d3koqc_ (3koq C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963461Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries)
  8. 2963465Domain d3koqc_: 3koq C: [212481]
    Other proteins in same PDB: d3koqa2
    automated match to d2b67a1
    complexed with cl, fmn, gol

Details for d3koqc_

PDB Entry: 3koq (more details), 1.58 Å

PDB Description: crystal structure of a nitroreductase family protein (cd3355) from clostridium difficile 630 at 1.58 a resolution
PDB Compounds: (C:) Nitroreductase family protein

SCOPe Domain Sequences for d3koqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3koqc_ d.90.1.0 (C:) automated matches {Clostridium difficile [TaxId: 272563]}
mnfvelakkryscrnyqdrkvekeklekvldvariaptggnrqpqrliviqekeginkls
kaaniydaplailvcgdkdkvwtrpfdgkqltdidtsivtdhmmlqatelglasvwvcyf
npdiireefslpdnlepinillmgyeskipesperhektrvplseivsyetl

SCOPe Domain Coordinates for d3koqc_:

Click to download the PDB-style file with coordinates for d3koqc_.
(The format of our PDB-style files is described here.)

Timeline for d3koqc_: