Lineage for d1a4ka2 (1a4k A:113-211)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289657Domain d1a4ka2: 1a4k A:113-211 [21248]
    Other proteins in same PDB: d1a4ka1, d1a4kb1, d1a4kb2, d1a4kh1, d1a4kh2, d1a4kl1
    part of humanized Diels-Alder catalytic Fab
    complexed with cd, fra

Details for d1a4ka2

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

SCOP Domain Sequences for d1a4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ka2 b.1.1.2 (A:113-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
yslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1a4ka2:

Click to download the PDB-style file with coordinates for d1a4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1a4ka2: