Lineage for d1a4ka2 (1a4k A:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748886Domain d1a4ka2: 1a4k A:108-211 [21248]
    Other proteins in same PDB: d1a4ka1, d1a4kb1, d1a4kb2, d1a4kh1, d1a4kh2, d1a4kl1
    part of humanized Diels-Alder catalytic Fab
    complexed with cd, fra

Details for d1a4ka2

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue
PDB Compounds: (A:) antibody fab

SCOPe Domain Sequences for d1a4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ka2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d1a4ka2:

Click to download the PDB-style file with coordinates for d1a4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1a4ka2: