Lineage for d3ko4d_ (3ko4 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920897Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2920898Protein automated matches [190596] (6 species)
    not a true protein
  7. 2920935Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries)
  8. 2920981Domain d3ko4d_: 3ko4 D: [212442]
    automated match to d3lmvf_
    protein/RNA complex; complexed with adp

Details for d3ko4d_

PDB Entry: 3ko4 (more details), 2.7 Å

PDB Description: crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with adp
PDB Compounds: (D:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d3ko4d_:

Sequence, based on SEQRES records: (download)

>d3ko4d_ c.110.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthdin

Sequence, based on observed residues (ATOM records): (download)

>d3ko4d_ c.110.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
twdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyndd
kikigkfgnymnidvtndgpvtiyidthdin

SCOPe Domain Coordinates for d3ko4d_:

Click to download the PDB-style file with coordinates for d3ko4d_.
(The format of our PDB-style files is described here.)

Timeline for d3ko4d_: