Lineage for d3ko4a_ (3ko4 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168191Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2168192Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2168239Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2168240Protein automated matches [190596] (5 species)
    not a true protein
  7. 2168274Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries)
  8. 2168335Domain d3ko4a_: 3ko4 A: [212439]
    automated match to d3lmvf_
    protein/RNA complex; complexed with adp

Details for d3ko4a_

PDB Entry: 3ko4 (more details), 2.7 Å

PDB Description: crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with adp
PDB Compounds: (A:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d3ko4a_:

Sequence, based on SEQRES records: (download)

>d3ko4a_ c.110.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthdi

Sequence, based on observed residues (ATOM records): (download)

>d3ko4a_ c.110.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvreleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
dkikigkfgnymnidvtndgpvtiyidthdi

SCOPe Domain Coordinates for d3ko4a_:

Click to download the PDB-style file with coordinates for d3ko4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ko4a_: