SCOPe 2.03: Domain d3ko3e_: 3ko3 E:

Lineage for d3ko3e_ (3ko3 E:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (2 families)
   active form is a dimer

5. Family c.110.1.0: automated matches [191422] (1 protein)
   not a true family

6. Protein automated matches [190596] (2 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [196467] (11 PDB entries)

8. Domain d3ko3e_: 3ko3 E: [212437]
   automated match to d3lmvf_
   protein/RNA complex; complexed with adp

Details for d3ko3e_

PDB Entry: 3ko3, 2.8 Å

PDB Description: d-tyrosyl-trna(tyr) deacylase from plasmodium falciparum incomplex with adp, obtained through soaking native enzyme crystal with the atp

PDB Compounds: (E:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d3ko3e_:

Sequence, based on SEQRES records:

>d3ko3e_ c.110.1.0 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthdinl

Sequence, based on observed residues (ATOM records):

>d3ko3e_ c.110.1.0 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
nddkikigkfgnymnidvtndgpvtiyidthdinl

Timeline for d3ko3e_:

• d3ko3e_ is new in SCOPe 2.03-stable
  
• d3ko3e_ appears in SCOPe 2.04
  
• d3ko3e_ appears in the current release, SCOPe 2.08