Lineage for d3knba_ (3knb A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519224Domain d3knba_: 3knb A: [212431]
    automated match to d3q5ob_
    complexed with so4

Details for d3knba_

PDB Entry: 3knb (more details), 1.4 Å

PDB Description: crystal structure of the titin c-terminus in complex with obscurin- like 1
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d3knba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3knba_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirs

SCOPe Domain Coordinates for d3knba_:

Click to download the PDB-style file with coordinates for d3knba_.
(The format of our PDB-style files is described here.)

Timeline for d3knba_: