SCOPe 2.08: Domain d3knba1: 3knb A:3-99

Lineage for d3knba1 (3knb A:3-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3knba1: 3knb A:3-99 [212431]
   Other proteins in same PDB: d3knba2
   automated match to d3q5ob_
   complexed with so4

Details for d3knba1

PDB Entry: 3knb, 1.4 Å

PDB Description: crystal structure of the titin c-terminus in complex with obscurin- like 1

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d3knba1:

Sequence; same for both SEQRES and ATOM records:

>d3knba1 b.1.1.0 (A:3-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientddl
ttliimdvqkqdgglytlslgnefgsdsatvnihirs

Timeline for d3knba1:

• d3knba1 first appeared in SCOPe 2.03, called d3knba_
  
• d3knba1 appears in SCOPe 2.07