Lineage for d1a4jh2 (1a4j H:120-217)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53443Species Diels alder catalytic Fab (mouse), kappa L chain [49060] (2 PDB entries)
  8. 53446Domain d1a4jh2: 1a4j H:120-217 [21243]
    Other proteins in same PDB: d1a4ja1, d1a4jb1, d1a4jh1, d1a4jl1

Details for d1a4jh2

PDB Entry: 1a4j (more details), 2.1 Å

PDB Description: diels alder catalytic antibody germline precursor

SCOP Domain Sequences for d1a4jh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4jh2 b.1.1.2 (H:120-217) Immunoglobulin (constant domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

SCOP Domain Coordinates for d1a4jh2:

Click to download the PDB-style file with coordinates for d1a4jh2.
(The format of our PDB-style files is described here.)

Timeline for d1a4jh2: