Lineage for d3kmob1 (3kmo B:1-78)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1855096Domain d3kmob1: 3kmo B:1-78 [212429]
    Other proteins in same PDB: d3kmoa2, d3kmob2
    automated match to d1gssa2
    complexed with ca, eaa, gsh; mutant

Details for d3kmob1

PDB Entry: 3kmo (more details), 2.6 Å

PDB Description: crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate (grown in the absence of the reducing agent dtt)
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3kmob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmob1 c.47.1.0 (B:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3kmob1:

Click to download the PDB-style file with coordinates for d3kmob1.
(The format of our PDB-style files is described here.)

Timeline for d3kmob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kmob2