| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (147 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries) |
| Domain d3km6b1: 3km6 B:1-78 [212421] Other proteins in same PDB: d3km6a2, d3km6b2 automated match to d1gssa2 complexed with ca, eaa, gsh; mutant |
PDB Entry: 3km6 (more details), 2.1 Å
SCOPe Domain Sequences for d3km6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3km6b1 c.47.1.0 (B:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
tlyqsntilrhlgrtlgl
Timeline for d3km6b1: