Lineage for d3km1a_ (3km1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031512Protein automated matches [190916] (10 species)
    not a true protein
  7. 2031531Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries)
  8. 2031535Domain d3km1a_: 3km1 A: [212417]
    automated match to d3pu7b_
    complexed with gol, zn

Details for d3km1a_

PDB Entry: 3km1 (more details), 2 Å

PDB Description: zinc-reconstituted tomato chloroplast superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3km1a_:

Sequence, based on SEQRES records: (download)

>d3km1a_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe
leddlgkgghelslttgnaggrlacgvvgltpi

Sequence, based on observed residues (ATOM records): (download)

>d3km1a_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheleddaggrlacgvv
gltpi

SCOPe Domain Coordinates for d3km1a_:

Click to download the PDB-style file with coordinates for d3km1a_.
(The format of our PDB-style files is described here.)

Timeline for d3km1a_: