Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein automated matches [226880] (4 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226011] (1 PDB entry) |
Domain d3kkyb2: 3kky B:99-210 [212410] Other proteins in same PDB: d3kkya1, d3kkyb1 automated match to d1y67a2 complexed with mn |
PDB Entry: 3kky (more details), 1.8 Å
SCOPe Domain Sequences for d3kkyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkyb2 d.44.1.1 (B:99-210) automated matches {Deinococcus radiodurans [TaxId: 1299]} psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d3kkyb2: