SCOP 1.61: Domain d1kb5h2: 1kb5 H:114-213

Lineage for d1kb5h2 (1kb5 H:114-213)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab Desire-1 (mouse), kappa L chain [49059] (1 PDB entry)

8. Domain d1kb5h2: 1kb5 H:114-213 [21241]
   Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h1, d1kb5l1

Details for d1kb5h2

PDB Entry: 1kb5, 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5h2:

Sequence; same for both SEQRES and ATOM records:

>d1kb5h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1kb5h2:

• d1kb5h2 first appeared (with stable ids) in SCOP 1.55
  
• d1kb5h2 appears in SCOP 1.59
  
• d1kb5h2 appears in SCOP 1.63
  
• d1kb5h2 appears in the current release, SCOPe 2.08