Lineage for d1kb5h2 (1kb5 H:114-213)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53764Species Fab Desire-1 (mouse), kappa L chain [49059] (1 PDB entry)
  8. 53765Domain d1kb5h2: 1kb5 H:114-213 [21241]
    Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h1, d1kb5l1

Details for d1kb5h2

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1kb5h2:

Click to download the PDB-style file with coordinates for d1kb5h2.
(The format of our PDB-style files is described here.)

Timeline for d1kb5h2: