Lineage for d3kkta_ (3kkt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2349737Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2349738Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
    Uniprot Q07343 324-667
  8. 2349786Domain d3kkta_: 3kkt A: [212404]
    automated match to d1xm6a_
    complexed with 0cp, b3p, mg, zn

Details for d3kkta_

PDB Entry: 3kkt (more details), 2.48 Å

PDB Description: Crystal structure of human PDE4b with 5-[3-[(1S,2S,4R)-Bicyclo[2.2.1]hept-2-yloxy]-4-methoxyp henyl]tetrahydro-2(1H)-pyrimidinone reveals ordering of the C-terminal helix residues 502-509.
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3kkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkta_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfe

SCOPe Domain Coordinates for d3kkta_:

Click to download the PDB-style file with coordinates for d3kkta_.
(The format of our PDB-style files is described here.)

Timeline for d3kkta_: