Lineage for d3kk6b2 (3kk6 B:74-584)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002906Species Sheep (Ovis aries) [TaxId:9940] [48137] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2002927Domain d3kk6b2: 3kk6 B:74-584 [212399]
    Other proteins in same PDB: d3kk6a1, d3kk6b1
    automated match to d1q4ga1
    complexed with bog, cel, flc, hem

Details for d3kk6b2

PDB Entry: 3kk6 (more details), 2.75 Å

PDB Description: crystal structure of cyclooxygenase-1 in complex with celecoxib
PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d3kk6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kk6b2 a.93.1.2 (B:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d3kk6b2:

Click to download the PDB-style file with coordinates for d3kk6b2.
(The format of our PDB-style files is described here.)

Timeline for d3kk6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kk6b1