Lineage for d3kjdb2 (3kjd B:365-579)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234104Protein automated matches [227023] (1 species)
    not a true protein
  7. 2234105Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)
  8. 2234107Domain d3kjdb2: 3kjd B:365-579 [212391]
    Other proteins in same PDB: d3kjda1, d3kjda3, d3kjdb1, d3kjdb3
    automated match to d1gs0a2
    protein/DNA complex; complexed with 78p, gol

Details for d3kjdb2

PDB Entry: 3kjd (more details), 1.95 Å

PDB Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor ABT-888
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d3kjdb2:

Sequence, based on SEQRES records: (download)

>d3kjdb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

Sequence, based on observed residues (ATOM records): (download)

>d3kjdb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
giytlnyneyivynpnqvrmryllkvqfnf

SCOPe Domain Coordinates for d3kjdb2:

Click to download the PDB-style file with coordinates for d3kjdb2.
(The format of our PDB-style files is described here.)

Timeline for d3kjdb2: