SCOP 1.67: Domain d1gpoi2: 1gpo I:114-212

Lineage for d1gpoi2 (1gpo I:114-212)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
Domain d1gpoi2: 1gpo I:114-212 [21239]
Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpol2, d1gpom1, d1gpom2
part of Fab M41 (artificial design)
complexed with so4

Details for d1gpoi2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpoi2 b.1.1.2 (I:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1gpoi2:

Click to download the PDB-style file with coordinates for d1gpoi2.
(The format of our PDB-style files is described here.)

Timeline for d1gpoi2: