SCOP 1.63: Domain d1gpoi2: 1gpo I:114-212

Lineage for d1gpoi2 (1gpo I:114-212)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Fab M41 (artificial design) [49058] (1 PDB entry)
Domain d1gpoi2: 1gpo I:114-212 [21239]
Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1
complexed with so4

Details for d1gpoi2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpoi2 b.1.1.2 (I:114-212) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1gpoi2:

Click to download the PDB-style file with coordinates for d1gpoi2.
(The format of our PDB-style files is described here.)

Timeline for d1gpoi2: