Lineage for d3kjda1 (3kjd A:235-364)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321349Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2321350Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2321375Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2321376Protein automated matches [226964] (1 species)
    not a true protein
  7. 2321377Species Human (Homo sapiens) [TaxId:9606] [225405] (47 PDB entries)
  8. 2321381Domain d3kjda1: 3kjd A:235-364 [212388]
    Other proteins in same PDB: d3kjda2, d3kjda3, d3kjdb2, d3kjdb3
    automated match to d1gs0a1
    protein/DNA complex; complexed with 78p, gol

Details for d3kjda1

PDB Entry: 3kjd (more details), 1.95 Å

PDB Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor ABT-888
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d3kjda1:

Sequence, based on SEQRES records: (download)

>d3kjda1 a.41.1.0 (A:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp
ehpldqhyrn

Sequence, based on observed residues (ATOM records): (download)

>d3kjda1 a.41.1.0 (A:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkspehpl
dqhyrn

SCOPe Domain Coordinates for d3kjda1:

Click to download the PDB-style file with coordinates for d3kjda1.
(The format of our PDB-style files is described here.)

Timeline for d3kjda1: