| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab M41 (artificial design) [49058] (1 PDB entry) |
| Domain d1gpom2: 1gpo M:113-218 [21238] Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1 |
PDB Entry: 1gpo (more details), 1.95 Å
SCOP Domain Sequences for d1gpom2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpom2 b.1.1.2 (M:113-218) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1gpom2: