Lineage for d1gpom2 (1gpo M:113-218)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221597Species Fab M41 (artificial design) [49058] (1 PDB entry)
  8. 221601Domain d1gpom2: 1gpo M:113-218 [21238]
    Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1

Details for d1gpom2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpom2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpom2 b.1.1.2 (M:113-218) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1gpom2:

Click to download the PDB-style file with coordinates for d1gpom2.
(The format of our PDB-style files is described here.)

Timeline for d1gpom2: