Lineage for d3kipa_ (3kip A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357747Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1358071Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 1358072Protein automated matches [191250] (2 species)
    not a true protein
  7. 1358076Species Yeast (Candida albicans) [TaxId:5476] [225888] (1 PDB entry)
  8. 1358077Domain d3kipa_: 3kip A: [212363]
    automated match to d1uqra_
    complexed with so4, trs

Details for d3kipa_

PDB Entry: 3kip (more details), 2.95 Å

PDB Description: Crystal structure of type-II 3-dehydroquinase from C. albicans
PDB Compounds: (A:) 3-dehydroquinase, type II

SCOPe Domain Sequences for d3kipa_:

Sequence, based on SEQRES records: (download)

>d3kipa_ c.23.13.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
lvkkvllingpnlnllgtrepekygttslsdieqaaieqaklknndsevlvfqsntegfi
idriheakrqgvgfvvinagaythtsvgirdallgtaipfievhitnvhqrepfrhqsyl
sdkavavicglgvygytaaieyalnyq

Sequence, based on observed residues (ATOM records): (download)

>d3kipa_ c.23.13.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
lvkkvllingpnlnllgtrygttslsdieqaaieqaklknndsevlvfqsntegfiidri
heakrqgvgfvvinagaythtsvgirdallgtaipfievhitnvhqrepfrhqsylsdka
vavicglgvygytaaieyalnyq

SCOPe Domain Coordinates for d3kipa_:

Click to download the PDB-style file with coordinates for d3kipa_.
(The format of our PDB-style files is described here.)

Timeline for d3kipa_: