Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (49 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [225812] (1 PDB entry) |
Domain d3khyb1: 3khy B:1-190 [212360] automated match to d1g99a1 |
PDB Entry: 3khy (more details), 1.98 Å
SCOPe Domain Sequences for d3khyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3khyb1 c.55.1.0 (B:1-190) automated matches {Francisella tularensis [TaxId: 119856]} mseilvlncgsssvkfalinphtsqslvtglaeniatknckvvfkaehkivkylengsyk dvfemlkdflvenkhlekivaighrvvhggqyfsksvlinadslekikacialaplhnpa hiegirfcqqifpelpqvavfdtafhqtmpsyiaeyaipyelthkhnirkygahgtshky vseqaakilt
Timeline for d3khyb1: