SCOPe 2.05: Domain d3khya2: 3khy A:191-384

Lineage for d3khya2 (3khy A:191-384)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [225812] (1 PDB entry)

8. Domain d3khya2: 3khy A:191-384 [212359]
   automated match to d1g99a2

Details for d3khya2

PDB Entry: 3khy, 1.98 Å

PDB Description: Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4

PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d3khya2:

Sequence; same for both SEQRES and ATOM records:

>d3khya2 c.55.1.0 (A:191-384) automated matches {Francisella tularensis [TaxId: 119856]}
qqkanvivahlgngcsitavvdgksidtsmgltpldglvmgtrsgcidpsifayisdnlg
wsvteitnmlnkqsgllgicghndmrevsqlaakgdslaklaieifshrvakfvasymiy
fnkldalvftggigenaanirkniisklanlgfmidhqknsnsetfinsknshnimviat
neelmiaqetqnli

Timeline for d3khya2:

• d3khya2 first appeared in SCOPe 2.03
  
• d3khya2 appears in SCOPe 2.04
  
• d3khya2 appears in SCOPe 2.06
  
• d3khya2 appears in the current release, SCOPe 2.08