| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Francisella tularensis [TaxId:119856] [225812] (1 PDB entry) |
| Domain d3khya2: 3khy A:191-384 [212359] automated match to d1g99a2 |
PDB Entry: 3khy (more details), 1.98 Å
SCOPe Domain Sequences for d3khya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3khya2 c.55.1.0 (A:191-384) automated matches {Francisella tularensis [TaxId: 119856]}
qqkanvivahlgngcsitavvdgksidtsmgltpldglvmgtrsgcidpsifayisdnlg
wsvteitnmlnkqsgllgicghndmrevsqlaakgdslaklaieifshrvakfvasymiy
fnkldalvftggigenaanirkniisklanlgfmidhqknsnsetfinsknshnimviat
neelmiaqetqnli
Timeline for d3khya2: