Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225798] (1 PDB entry) |
Domain d3khpd1: 3khp D:3-141 [212354] automated match to d1pn2a1 complexed with cl, tla |
PDB Entry: 3khp (more details), 2.3 Å
SCOPe Domain Sequences for d3khpd1:
Sequence, based on SEQRES records: (download)
>d3khpd1 d.38.1.0 (D:3-141) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} idpnsigavtepmlfewtdrdtllyaigvgagtgdlafttenshgidqqvlptyaviccp afgaaakvgtfnpaallhgsqgirlhaplpaagklsvvtevadiqdkgegknaivvlrgr gcdpesgslvaetlttlvl
>d3khpd1 d.38.1.0 (D:3-141) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} idpnsigavtepmlfewtdrdtllyaigvgagtgdlafttenshgidqqvlptyaviccp afgaaakvaallhgsqgirlhaplpaagklsvvtevadiqdkgeaivvlrgrgcdpesgs lvaetlttlvl
Timeline for d3khpd1: