Lineage for d3khpd1 (3khp D:3-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944486Species Mycobacterium tuberculosis [TaxId:83332] [225798] (1 PDB entry)
  8. 2944489Domain d3khpd1: 3khp D:3-141 [212354]
    automated match to d1pn2a1
    complexed with cl, tla

Details for d3khpd1

PDB Entry: 3khp (more details), 2.3 Å

PDB Description: crystal structure of a possible dehydrogenase from mycobacterium tuberculosis at 2.3a resolution
PDB Compounds: (D:) MaoC family protein

SCOPe Domain Sequences for d3khpd1:

Sequence, based on SEQRES records: (download)

>d3khpd1 d.38.1.0 (D:3-141) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
idpnsigavtepmlfewtdrdtllyaigvgagtgdlafttenshgidqqvlptyaviccp
afgaaakvgtfnpaallhgsqgirlhaplpaagklsvvtevadiqdkgegknaivvlrgr
gcdpesgslvaetlttlvl

Sequence, based on observed residues (ATOM records): (download)

>d3khpd1 d.38.1.0 (D:3-141) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
idpnsigavtepmlfewtdrdtllyaigvgagtgdlafttenshgidqqvlptyaviccp
afgaaakvaallhgsqgirlhaplpaagklsvvtevadiqdkgeaivvlrgrgcdpesgs
lvaetlttlvl

SCOPe Domain Coordinates for d3khpd1:

Click to download the PDB-style file with coordinates for d3khpd1.
(The format of our PDB-style files is described here.)

Timeline for d3khpd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3khpd2