Lineage for d1jrhh2 (1jrh H:114-221)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655684Domain d1jrhh2: 1jrh H:114-221 [21235]
    Other proteins in same PDB: d1jrhh1, d1jrhi_, d1jrhl1, d1jrhl2
    part of Fab A6
    mutant

Details for d1jrhh2

PDB Entry: 1jrh (more details), 2.8 Å

PDB Description: complex (antibody/antigen)
PDB Compounds: (H:) antibody a6

SCOP Domain Sequences for d1jrhh2:

Sequence, based on SEQRES records: (download)

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdk

Sequence, based on observed residues (ATOM records): (download)

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpclvyfpepvtvtwnsgssgvhtfpavlqsdlytlsssvtcnvahpasstkvdk

SCOP Domain Coordinates for d1jrhh2:

Click to download the PDB-style file with coordinates for d1jrhh2.
(The format of our PDB-style files is described here.)

Timeline for d1jrhh2: