SCOP 1.63: Domain d1jrhh2: 1jrh H:114-221

Lineage for d1jrhh2 (1jrh H:114-221)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab A6 (mouse), kappa L chain [49057] (1 PDB entry)

8. Domain d1jrhh2: 1jrh H:114-221 [21235]
   Other proteins in same PDB: d1jrhh1, d1jrhi_, d1jrhl1
   mutant

Details for d1jrhh2

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhh2:

Sequence, based on SEQRES records:

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdk

Sequence, based on observed residues (ATOM records):

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
akttpclvyfpepvtvtwnsgssgvhtfpavlqsdlytlsssvtcnvahpasstkvdk

Timeline for d1jrhh2:

• d1jrhh2 first appeared (with stable ids) in SCOP 1.55
  
• d1jrhh2 appears in SCOP 1.61
  
• d1jrhh2 appears in SCOP 1.65
  
• d1jrhh2 appears in the current release, SCOPe 2.08