SCOPe 2.05: Domain d3ke5c_: 3ke5 C:

Lineage for d3ke5c_ (3ke5 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (6 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [225983] (2 PDB entries)

8. Domain d3ke5c_: 3ke5 C: [212348]
   automated match to d3ci4a_
   complexed with atp, mg

Details for d3ke5c_

PDB Entry: 3ke5, 2 Å

PDB Description: crystal structure of a pduo-type atp:cob(i)alamin adenosyltransferase from bacillus cereus in a complex with atp

PDB Compounds: (C:) hypothetical cytosolic protein

SCOPe Domain Sequences for d3ke5c_:

Sequence; same for both SEQRES and ATOM records:

>d3ke5c_ a.25.2.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]}
lytktgdkgttsviggrvdkddirveaygtideanshigyamtklqggafidiyneleni
qhelfdcggdlaiveqkipykvtivmveslerkidlyieeapplerfilpggseaaatih
iartvvrraersivslqkevkinevvlkyvnrlsdylfaiarvinarlqvkdveynrsa

Timeline for d3ke5c_:

• d3ke5c_ first appeared in SCOPe 2.03
  
• d3ke5c_ appears in SCOPe 2.04
  
• d3ke5c_ appears in SCOPe 2.06
  
• d3ke5c_ appears in the current release, SCOPe 2.08