Lineage for d3ke4c_ (3ke4 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1992598Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1992617Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 1992618Protein automated matches [190652] (6 species)
    not a true protein
  7. 1992619Species Bacillus cereus [TaxId:226900] [225983] (2 PDB entries)
  8. 1992622Domain d3ke4c_: 3ke4 C: [212345]
    automated match to d3ci4a_
    complexed with dio

Details for d3ke4c_

PDB Entry: 3ke4 (more details), 1.9 Å

PDB Description: crystal structure of a pduo-type atp:cob(i)alamin adenosyltransferase from bacillus cereus
PDB Compounds: (C:) hypothetical cytosolic protein

SCOPe Domain Sequences for d3ke4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ke4c_ a.25.2.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]}
gttsviggrvdkddirveaygtideanshigyamtklqggafidiyneleniqhelfdcg
gdlaiveqkipykvtivmveslerkidlyieeapplerfilpggseaaatihiartvvrr
aersivslqkevkinevvlkyvnrlsdylfaiarvinarlqvkdveynr

SCOPe Domain Coordinates for d3ke4c_:

Click to download the PDB-style file with coordinates for d3ke4c_.
(The format of our PDB-style files is described here.)

Timeline for d3ke4c_: