SCOPe 2.08: Domain d3kdoj2: 3kdo J:136-444

Lineage for d3kdoj2 (3kdo J:136-444)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (9 species)
   not a true protein

7. Species Thermococcus kodakaraensis [TaxId:69014] [226770] (2 PDB entries)

8. Domain d3kdoj2: 3kdo J:136-444 [212342]
   Other proteins in same PDB: d3kdoa1, d3kdob1, d3kdoc1, d3kdod1, d3kdoe1, d3kdof1, d3kdog1, d3kdoh1, d3kdoi1, d3kdoj1
   automated match to d1bxna1
   complexed with cap, mg; mutant

Details for d3kdoj2

PDB Entry: 3kdo, 2.36 Å

PDB Description: crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp

PDB Compounds: (J:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdoj2:

Sequence; same for both SEQRES and ATOM records:

>d3kdoj2 c.1.14.0 (J:136-444) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditlgfvdllreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

Timeline for d3kdoj2:

• d3kdoj2 first appeared in SCOPe 2.03
  
• d3kdoj2 appears in SCOPe 2.07