SCOPe 2.07: Domain d3kdog1: 3kdo G:8-135

Lineage for d3kdog1 (3kdo G:8-135)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Thermococcus kodakaraensis [TaxId:69014] [225982] (2 PDB entries)

8. Domain d3kdog1: 3kdo G:8-135 [212335]
   Other proteins in same PDB: d3kdoa2, d3kdob2, d3kdoc2, d3kdod2, d3kdoe2, d3kdof2, d3kdog2, d3kdoh2, d3kdoi2, d3kdoj2
   automated match to d1bxna2
   complexed with cap, mg; mutant

Details for d3kdog1

PDB Entry: 3kdo, 2.36 Å

PDB Description: crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp

PDB Compounds: (G:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdog1:

Sequence; same for both SEQRES and ATOM records:

>d3kdog1 d.58.9.0 (G:8-135) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
fpeklire

Timeline for d3kdog1:

• d3kdog1 first appeared in SCOPe 2.03
  
• d3kdog1 appears in SCOPe 2.06
  
• d3kdog1 appears in the current release, SCOPe 2.08