Lineage for d3kdog1 (3kdo G:8-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953282Species Thermococcus kodakaraensis [TaxId:69014] [225982] (2 PDB entries)
  8. 2953299Domain d3kdog1: 3kdo G:8-135 [212335]
    Other proteins in same PDB: d3kdoa2, d3kdob2, d3kdoc2, d3kdod2, d3kdoe2, d3kdof2, d3kdog2, d3kdoh2, d3kdoi2, d3kdoj2
    automated match to d1bxna2
    complexed with cap, mg; mutant

Details for d3kdog1

PDB Entry: 3kdo (more details), 2.36 Å

PDB Description: crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
PDB Compounds: (G:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdog1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdog1 d.58.9.0 (G:8-135) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
fpeklire

SCOPe Domain Coordinates for d3kdog1:

Click to download the PDB-style file with coordinates for d3kdog1.
(The format of our PDB-style files is described here.)

Timeline for d3kdog1: