![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
![]() | Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries) |
![]() | Domain d1ahwe2: 1ahw E:118-214 [21233] Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwf1, d1ahwf2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwe2 b.1.1.2 (E:118-214) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkki
Timeline for d1ahwe2: