Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
Protein automated matches [227123] (7 species) not a true protein |
Species Thermococcus kodakaraensis [TaxId:69014] [226770] (2 PDB entries) |
Domain d3kdoc2: 3kdo C:136-444 [212328] Other proteins in same PDB: d3kdoa1, d3kdob1, d3kdoc1, d3kdod1, d3kdoe1, d3kdof1, d3kdog1, d3kdoh1, d3kdoi1, d3kdoj1 automated match to d1bxna1 complexed with cap, mg; mutant |
PDB Entry: 3kdo (more details), 2.36 Å
SCOPe Domain Sequences for d3kdoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kdoc2 c.1.14.0 (C:136-444) automated matches {Thermococcus kodakaraensis [TaxId: 69014]} fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv gtagagklegerditlgfvdllreshykpdendvfhleqkfysikaafptssgglhpgni qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral ekwghvtpv
Timeline for d3kdoc2: