Lineage for d3kdnh2 (3kdn H:136-444)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100959Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2100960Protein automated matches [227123] (7 species)
    not a true protein
  7. 2101002Species Thermococcus kodakaraensis [TaxId:69014] [226770] (2 PDB entries)
  8. 2101010Domain d3kdnh2: 3kdn H:136-444 [212318]
    Other proteins in same PDB: d3kdna1, d3kdnb1, d3kdnc1, d3kdnd1, d3kdne1, d3kdnf1, d3kdng1, d3kdnh1, d3kdni1, d3kdnj1
    automated match to d1bxna1
    complexed with cap, mg; mutant

Details for d3kdnh2

PDB Entry: 3kdn (more details), 2.09 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
PDB Compounds: (H:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdnh2 c.1.14.0 (H:136-444) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

SCOPe Domain Coordinates for d3kdnh2:

Click to download the PDB-style file with coordinates for d3kdnh2.
(The format of our PDB-style files is described here.)

Timeline for d3kdnh2: