SCOPe 2.05: Domain d3kdnh2: 3kdn H:136-444

Lineage for d3kdnh2 (3kdn H:136-444)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (6 species)
   not a true protein

7. Species Thermococcus kodakaraensis [TaxId:69014] [226770] (2 PDB entries)

8. Domain d3kdnh2: 3kdn H:136-444 [212318]
   Other proteins in same PDB: d3kdna1, d3kdnb1, d3kdnc1, d3kdnd1, d3kdne1, d3kdnf1, d3kdng1, d3kdnh1, d3kdni1, d3kdnj1
   automated match to d1bxna1
   complexed with cap, mg; mutant

Details for d3kdnh2

PDB Entry: 3kdn, 2.09 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp

PDB Compounds: (H:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdnh2:

Sequence; same for both SEQRES and ATOM records:

>d3kdnh2 c.1.14.0 (H:136-444) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

Timeline for d3kdnh2:

• d3kdnh2 first appeared in SCOPe 2.03
  
• d3kdnh2 appears in SCOPe 2.04
  
• d3kdnh2 appears in SCOPe 2.06
  
• d3kdnh2 appears in the current release, SCOPe 2.08