SCOP 1.63: Domain d1ahwb2: 1ahw B:118-214

Lineage for d1ahwb2 (1ahw B:118-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries)

8. Domain d1ahwb2: 1ahw B:118-214 [21231]
   Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwf1, d1ahwf2

Details for d1ahwb2

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwb2:

Sequence; same for both SEQRES and ATOM records:

>d1ahwb2 b.1.1.2 (B:118-214) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1ahwb2:

• d1ahwb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwb2 appears in SCOP 1.61
  
• d1ahwb2 appears in SCOP 1.65
  
• d1ahwb2 appears in the current release, SCOPe 2.08