Lineage for d3kdna1 (3kdn A:8-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953282Species Thermococcus kodakaraensis [TaxId:69014] [225982] (2 PDB entries)
  8. 2953283Domain d3kdna1: 3kdn A:8-135 [212303]
    Other proteins in same PDB: d3kdna2, d3kdnb2, d3kdnc2, d3kdnd2, d3kdne2, d3kdnf2, d3kdng2, d3kdnh2, d3kdni2, d3kdnj2
    automated match to d1bxna2
    complexed with cap, mg; mutant

Details for d3kdna1

PDB Entry: 3kdn (more details), 2.09 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdna1 d.58.9.0 (A:8-135) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
fpeklire

SCOPe Domain Coordinates for d3kdna1:

Click to download the PDB-style file with coordinates for d3kdna1.
(The format of our PDB-style files is described here.)

Timeline for d3kdna1: