Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d3kdml1: 3kdm L:3-111 [212301] Other proteins in same PDB: d3kdmb_, d3kdmh_ automated match to d1sy6l1 complexed with tes |
PDB Entry: 3kdm (more details), 1.5 Å
SCOPe Domain Sequences for d3kdml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kdml1 b.1.1.0 (L:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} altqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgvsn rfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveik
Timeline for d3kdml1:
View in 3D Domains from other chains: (mouse over for more information) d3kdma1, d3kdma2, d3kdmb_, d3kdmh_ |