Lineage for d1ahwa2 (1ahw A:109-214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934293Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 934519Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 934848Domain d1ahwa2: 1ahw A:109-214 [21230]
    Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwe2, d1ahwf1, d1ahwf2
    part of anti-human tissue factor Fab 5G9

Details for d1ahwa2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
PDB Compounds: (A:) immunoglobulin fab 5g9 (light chain)

SCOPe Domain Sequences for d1ahwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwa2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1ahwa2:

Click to download the PDB-style file with coordinates for d1ahwa2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwa2: