Lineage for d1ahwa2 (1ahw A:109-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220990Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries)
  8. 220993Domain d1ahwa2: 1ahw A:109-214 [21230]
    Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwf1, d1ahwf2

Details for d1ahwa2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwa2 b.1.1.2 (A:109-214) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ahwa2:

Click to download the PDB-style file with coordinates for d1ahwa2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwa2: