Lineage for d3kcza2 (3kcz A:365-579)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000666Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 3000690Protein automated matches [227023] (1 species)
    not a true protein
  7. 3000691Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)
  8. 3000694Domain d3kcza2: 3kcz A:365-579 [212296]
    Other proteins in same PDB: d3kcza1, d3kcza3, d3kczb1, d3kczb3
    automated match to d1gs0a2
    protein/DNA complex; complexed with 3ab, gol

Details for d3kcza2

PDB Entry: 3kcz (more details), 2 Å

PDB Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor 3-aminobenzamide
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d3kcza2:

Sequence, based on SEQRES records: (download)

>d3kcza2 d.166.1.2 (A:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

Sequence, based on observed residues (ATOM records): (download)

>d3kcza2 d.166.1.2 (A:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilgytlnyneyivynpnqvrmryllkvqfnf

SCOPe Domain Coordinates for d3kcza2:

Click to download the PDB-style file with coordinates for d3kcza2.
(The format of our PDB-style files is described here.)

Timeline for d3kcza2: