![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family) ![]() automatically mapped to Pfam PF09259 |
![]() | Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (2 proteins) |
![]() | Protein automated matches [191068] (2 species) not a true protein |
![]() | Species Ganoderma microsporum [TaxId:34462] [226009] (1 PDB entry) |
![]() | Domain d3kcwa_: 3kcw A: [212294] automated match to d3f3ha_ |
PDB Entry: 3kcw (more details), 2 Å
SCOPe Domain Sequences for d3kcwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcwa_ b.1.21.1 (A:) automated matches {Ganoderma microsporum [TaxId: 34462]} sdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlgv rpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwn
Timeline for d3kcwa_: