SCOPe 2.07: Domain d3kccb1: 3kcc B:9-137

Lineage for d3kccb1 (3kcc B:9-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)

8. Domain d3kccb1: 3kcc B:9-137 [212287]
   Other proteins in same PDB: d3kcca2, d3kccb2
   automated match to d1g6na2
   complexed with cmp; mutant

Details for d3kccb1

PDB Entry: 3kcc, 1.66 Å

PDB Description: Crystal structure of D138L mutant of Catabolite Gene Activator Protein

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3kccb1:

Sequence; same for both SEQRES and ATOM records:

>d3kccb1 b.82.3.2 (B:9-137) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

Timeline for d3kccb1:

• d3kccb1 first appeared in SCOPe 2.03
  
• d3kccb1 appears in SCOPe 2.06
  
• d3kccb1 appears in the current release, SCOPe 2.08